PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000107G1130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 573aa    MW: 61300.4 Da    PI: 6.6687
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000107G1130genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.2e-093423791954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  PH01000107G1130 342 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 379
                      664459******************************88 PP

2BELL811.6e-26206274472
             BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      elq+ k +L  +leeVd+ Y++y+eq++ ++s Feav g  +a+ Yt+lA+++iSrhFr+L+d i++q+
  PH01000107G1130 206 ELQRLKDRLYIMLEEVDRTYRRYCEQMRGLASGFEAVGGERAAAAYTALASRTISRHFRNLRDGIVGQL 274
                      89999*************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-40140272IPR006563POX domain
PfamPF075264.9E-39146270IPR006563POX domain
PROSITE profilePS5007111.904320383IPR001356Homeobox domain
SMARTSM003897.3E-7323387IPR001356Homeobox domain
CDDcd000863.45E-12323384No hitNo description
SuperFamilySSF466895.56E-17324390IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27326389IPR009057Homeodomain-like
PfamPF059201.5E-17340379IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MAHDPSMGFA DYFSAADATA VSVATLMPAM DEGAPELFGL QSGMELLGMR GLAAMPGTAS  60
AAASAAHSKA VLMDAGGDGF TMRFLSEQQQ QQHHQPSQAP LSLSLCRPEG VLHLHQHLGG  120
SSGQQPAPAA WMHDSSAPHG HGAWHLRSSR FLLPAQQLLQ EFCSLPVDST KRTKAPRPPQ  180
QAEDGGSSSS ASWTPSPHIQ SMDALELQRL KDRLYIMLEE VDRTYRRYCE QMRGLASGFE  240
AVGGERAAAA YTALASRTIS RHFRNLRDGI VGQLQAVRKA LGEKDVTVPG MTRGETPRLR  300
VLDQSIRQQK ALHQPGMMDS HPWRPQRGLP ERAVTILRAW MFEHFLHPYP SDVDKHILAR  360
QTGLSRSQVS NWFINARVRL WKPMVEEMYV EEMKDQDGGG SGGQGSLNPN PSSHPSDGQL  420
VDAGDGDGGD QKPTRAQLLH DAGSLASVVN IGSVARAGAR MENFGIMDHL DFDAYDSQGG  480
FGTGGGGVSL TLGLQQHDSH HGGGVNIAFG EPSAHGGGAG FLSPAGEQMD GVHPGHGHHV  540
QFGAGMDGDA SHGQEHYRGL NAGFHLLRDL AG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A8e-17329386158Homeobox protein Meis1
4xrs_B8e-17329386158Homeobox protein Meis1
5bng_A8e-17329387159Homeobox protein Meis2
5bng_B8e-17329387159Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1212070.0AK121207.1 Oryza sativa Japonica Group cDNA clone:J023088C15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628192.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLQ10SF70.0Q10SF7_ORYSJ; Associated with HOX family protein, expressed
STRINGLOC_Os03g03260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.23e-82BEL1-like homeodomain 2